PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_10360V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 547aa    MW: 60608.4 Da    PI: 7.4598
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_10360V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-17155200147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg W + Ede+l ++v q+G+ +W++Ia+++  gR++k+c++rw++ 
  Pp3c12_10360V3.1.p 155 RGHWRPAEDEKLRELVSQYGPQNWNLIAEKLH-GRSGKSCRLRWFNQ 200
                         899*****************************.***********996 PP

2Myb_DNA-binding55.41.4e-17207251147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r ++T++E+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ +
  Pp3c12_10360V3.1.p 207 RRPFTEDEEERLLAAHRFHGNK-WAMIARLFP-GRTDNAVKNHWHVV 251
                         679*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7150201IPR017930Myb domain
SuperFamilySSF466891.2E-28154248IPR009057Homeodomain-like
SMARTSM007172.6E-14154203IPR001005SANT/Myb domain
PfamPF002493.8E-16155200IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-27156208IPR009057Homeodomain-like
CDDcd001673.39E-13158199No hitNo description
PROSITE profilePS5129425.487202256IPR017930Myb domain
SMARTSM007179.1E-15206254IPR001005SANT/Myb domain
PfamPF002499.0E-14207250IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-20209255IPR009057Homeodomain-like
CDDcd001671.91E-11209252No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MCLHFAEEET KRMQSYEFHR TASVQQSPHQ HHMASSYSPT LASYSLAGVT TSSTSADTAY  60
ITDGEGTSNS GSDVTPVACK VSTIPFQALG VMPSEEGHMW WMRSEYNQEV KQSSDEDMEQ  120
GSMDEMKEST SEDVEHKSVG RDTMDGAVQS KLCPRGHWRP AEDEKLRELV SQYGPQNWNL  180
IAEKLHGRSG KSCRLRWFNQ LDPRINRRPF TEDEEERLLA AHRFHGNKWA MIARLFPGRT  240
DNAVKNHWHV VMARKFRERS RSSGRRKAQA PRRGRRPSSS SVPLGHHARS LKAWIEKQAP  300
TIPSGEVSDT SLPTDHSQLF NPSPGNRSVN NSNVSMSPPS FHPGFLFPQH ETFRNLGAAR  360
FSEHSMEGAV PSSSATTTPL APSLSSRRLS QPAAHLGLQM LHEQKPPLQD DTSPPSTDSL  420
VGVMMRHGGL CAAPAASQWV PSLVNPFATV RDNQRDEAAR NFLASSCRAE IQRQFEGQHG  480
HGDPRFGGHS EVSYSIRQSA EQPELQRDLG SLLAWGRTTQ GQELALSHPE PAPSVPFIDF  540
LGVGVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-311552557107B-MYB
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S91_13V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-64myb domain protein 105